Timezone:Eastern Daylight Time
Current Time:Wednesday, September 16, 2026 5:10 AM
Longitude:-77.8084747
Latitude:39.6026514
Sunrise Time Today:6:54:30 AM
Sunset Time Today:7:20:32 PM
Daylength Today:12h 26m 1s
Sunrise Time Tomorrow:6:55:25 AM
Sunset Time Tomorrow:7:18:53 PM
Daylength Tomorrow:12h 23m 27s

: Show All Dates

Date Sunrise Time Sunset Time Daylength
Jan 1, 2026 7:33:01 AM 4:57:55 PM 9h 24m 53s
Feb 1, 2026 7:21:12 AM 5:30:37 PM 10h 9m 25s
Mar 1, 2026 6:47:22 AM 6:03:09 PM 11h 15m 46s
Apr 1, 2026 6:58:21 AM 7:34:46 PM 12h 36m 25s
May 1, 2026 6:14:34 AM 8:04:43 PM 13h 50m 8s
Jun 1, 2026 5:47:37 AM 8:33:08 PM 14h 45m 31s
Jul 1, 2026 5:48:02 AM 8:44:02 PM 14h 55m 59s
Aug 1, 2026 6:10:45 AM 8:26:54 PM 14h 16m 9s
Sep 1, 2026 6:39:51 AM 7:46:20 PM 13h 6m 28s
Sep 16, 2026 6:53:36 AM 7:22:11 PM 12h 28m 35s
Sep 17, 2026 6:54:30 AM 7:20:32 PM 12h 26m 1s
Oct 1, 2026 7:07:29 AM 6:57:28 PM 11h 49m 59s
Nov 1, 2026 7:39:35 AM 6:12:34 PM 10h 32m 58s
Dec 1, 2026 7:13:10 AM 4:49:36 PM 9h 36m 26s

Sunrise & Sunset Photos

Home to the Shadows by jeffsmallwood, I'd planned to get up early and go shooting, but I couldn't sleep which made it much easier to get m
Home to the Shadows by jeffsmallwood
Hagerstown, Maryland, USA by takasphoto.com, Living in California for a while, we sometimes miss the east coast - from these impressive clouds, g
Hagerstown, Maryland, USA by takasphoto.com
Electrics at Sunset in Hagerstown by DJ Witty, Two Conrail E44s lead four RF&P GPs on an eastbound freight over the Western Maryland Railway at
Electrics at Sunset in Hagerstown by DJ Witty
130724-4644 Antietam by WashuOtaku, Monument to the 132nd Pennsylvania Volunteer Infantry Regiment; located within Sunken Road (Bloody L
130724-4644 Antietam by WashuOtaku
The Sky of Hagerstown in Dusk, Maryland, USA by takasphoto.com, Living in California for a while, we sometimes miss the east coast - from these impressive clouds, g
The Sky of Hagerstown in Dusk, Maryland, USA by takasphoto.com
Sunset On The Six Eight by T-3 Photography, A view of yesterday's sunset from Maryland 68, near Clear Spring. This HDR image was created from t
Sunset On The Six Eight by T-3 Photography
Good Morning Tree by jeffsmallwood, While I was at Antietam Battlefield for sunrise the sky was changing dramatically from minute to min
Good Morning Tree by jeffsmallwood
Hagerstown MD City Park statue at sundown by PhotosToArtByMike, Print size 13x19 inches.sunset fountain statue sundown artmuseum citypark westernmaryland washington
Hagerstown MD City Park statue at sundown by PhotosToArtByMike
Hagerstown MD City Park Art Museum at sundown by PhotosToArtByMike, Caught a nice sunset at the park. The lights in the museum lit up as I snapped the photo. Print siz
Hagerstown MD City Park Art Museum at sundown by PhotosToArtByMike
Sunrise Over South Mountain by T-3 Photography, A few of the sunrise over South Mountain from behind the Zion United Church of Christ Church in Hage
Sunrise Over South Mountain by T-3 Photography
A Hagerstown Sunrise, MT. Tabor Church and Cemetary by PhotosToArtByMike, Mt. Tabor Church, about 10 miles west of Hagerstown is near the Appalachian Mountains. Print size 1
A Hagerstown Sunrise, MT. Tabor Church and Cemetary by PhotosToArtByMike
Hagerstown MD, the City Park at twilight by PhotosToArtByMike, Print size 8x10 inches.sunset landscape twilight sundown scenic artmuseum citypark westernmaryland w
Hagerstown MD, the City Park at twilight by PhotosToArtByMike
Digital colored pencil sketch on course paper surface by PhotosToArtByMike, Cushwa's Coal and Brick warehouse on the C&O Canal Towpath, Williamsport Maryland. Print size 8x
Digital colored pencil sketch on course paper surface by PhotosToArtByMike
The Mount Tabor Church Graveyard at sunset by PhotosToArtByMike, Mt. Tabor Church cemetery, Hagerstown Maryland. Print size 13x19 inches. sunset westernmaryland was
The Mount Tabor Church Graveyard at sunset by PhotosToArtByMike
Double Set by T-3 Photography, Last night's sunset over the Potomac River.
Double Set by T-3 Photography
Mountain View by T-3 Photography, A view west from US-40 just up the hill from Clear Spring, MD.sunset mountains rural canon maryland
Mountain View by T-3 Photography
Bridge Over Antietam Creek by jeffsmallwood, This spot is several miles from <a href="http://www.nps.gov/ANTI/" target="blank" rel="nofollow">Ant
Bridge Over Antietam Creek by jeffsmallwood
WW 86 - Falling Waters, WV by T-3 Photography, An evening northbound meanders its way through Falling Waters on it's way to Norfolk Southern's Vard
WW 86 - Falling Waters, WV by T-3 Photography
Antietam's Bloody Lane by TheGreenHeron, Snake rail fence along Bloody Lane, Antietam National Battlefield, Sharpsburg Maryland. I liked the
Antietam's Bloody Lane by TheGreenHeron
On The Opposite Side by jeffsmallwood, This <a href="http://www.flickr.com/photos/jeffsmallwood/5673169265/in/photostream" target="blank">f
On The Opposite Side by jeffsmallwood
Something New by jeffsmallwood, I've been playing with some different post-processing techniques, trying some combinations of things
Something New by jeffsmallwood
Sunrise at Antietam Battlefield by jeffsmallwood, Here's another shot from sunrise at Antietam Battlefield. It's quite a feeling to sit in battlefield
Sunrise at Antietam Battlefield by jeffsmallwood
Antietam Battlefield circa 2011 by jeffsmallwood, The <a href="http://en.wikipedia.org/wiki/Battle_of_Antietam" target="blank" rel="nofollow">Battle o
Antietam Battlefield circa 2011 by jeffsmallwood
Antietam Battlefield, the Maryland Monument at sundown by PhotosToArtByMike, Print size 8x10 inches.sunset landscape md sundown scenic maryland antietambattlefield sharpsburgmd
Antietam Battlefield, the Maryland Monument at sundown by PhotosToArtByMike
The Cornfield by stackingpixels, Antietam at 150fog sunrise day thecornfield uploaded:by=flickrmobile flickriosapp:filter=nofilter
The Cornfield by stackingpixels
Clouds over Hagerstown, Maryland by SchuminWeb, Clouds over Hagerstown, Maryland near Valley Mall, at sunset. <i>Ben Schumin is a professional phot
Clouds over Hagerstown, Maryland by SchuminWeb
Morning on the Conococheague Creek in Williamsport MD by PhotosToArtByMike, Print size 13x19 inches. morning sunrise landscape md scenic maryland potomacriver cocanal cushwa ca
Morning on the Conococheague Creek in Williamsport MD by PhotosToArtByMike
Hagerstown, Maryland, USA by takasphoto.com, Living in California for a while, we sometimes miss the east coast - from these impressive clouds, g
Hagerstown, Maryland, USA by takasphoto.com
Williamsport, MD: Waffle House (digital) by smohundro, sunset sky building sign maryland wafflehouse williamsport sunoco kodachrome64preset
Williamsport, MD: Waffle House (digital) by smohundro
Antietam - The Maryland Monument at sundown by PhotosToArtByMike, Print size 8x10 inches.sunset landscape md sundown scenic maryland antietambattlefield sharpsburgmd
Antietam - The Maryland Monument at sundown by PhotosToArtByMike
CUSHWA BASIN SUNSET by The Wright Photography of Things, CUSHWA BASIN SUNSET The Chesapeake and Ohio Canal, once an important industrial link to the region n
CUSHWA BASIN SUNSET by The Wright Photography of Things
gnarled by Eric Sturdivant, longexposure sky usa tree clouds us md unitedstates unitedstatesofamerica maryland places antietam l
gnarled by Eric Sturdivant
The Cornfield by stackingpixels, Antietam at 150sunrise day clear thecornfield uploaded:by=flickrmobile flickriosapp:filter=nofilter
The Cornfield by stackingpixels
Sunset on the Potomac River by JoelDeluxe, trees sunset river dusk wv westvirginia frame potomac joeldeluxe shepherdstown clearwater substrate
Sunset on the Potomac River by JoelDeluxe
Mount Tabor Church, Hagerstown Maryland by PhotosToArtByMike, Mt. Tabor Church, about 10 miles west of Hagerstown is near the Appalachian Mountains. Print size 1
Mount Tabor Church, Hagerstown Maryland by PhotosToArtByMike
Moonrise over Hagerstown Speedway by Glenn Courtney, race md maryland racing dirt opal oval hagerstown sprintcar pennsylvaniasprintcarspeedweek
Moonrise over Hagerstown Speedway by Glenn Courtney
Antietam, sunset in the North Woods by Msanders55, Monument for the 36th Pennsylvania Infantry, near the Poffenberger Farm and the North Woods. This wa
Antietam, sunset in the North Woods by Msanders55
A digital painting of the Cushwa's Coal and Brick warehouse by PhotosToArtByMike, Cushwa's Coal and Brick warehouse, Williamsport Maryland. Print Size 13x19 inches.sunrise md marylan
A digital painting of the Cushwa's Coal and Brick warehouse by PhotosToArtByMike
137th PA Infantry at Sunrise - Antietam by ronzzo1, cwt13bf nikondslrd80civilwarbattlefieldmarylandantietamsharpsburgnationalparkmonument
137th PA Infantry at Sunrise - Antietam by ronzzo1
Antietam Battlefield by Victor Dvorak, Site of the bloodiest one-day battle of the Civil War with approximately 23,000 casualties (killed,
Antietam Battlefield by Victor Dvorak
Hold Tight by jeffsmallwood, This tree really is leaning out over the water, it isn't just the low angle perspective that makes i
Hold Tight by jeffsmallwood
130724-4619 Antietam by WashuOtaku, <b>The East Woods <i>"The shells crashing through the trees and fluttering overhead as well as
130724-4619 Antietam by WashuOtaku
Mount Tabor Church Graveyard, a two minute exposure by PhotosToArtByMike, Mt. Tabor Church cemetery, Hagerstown Maryland. Print size 13x19 inches. sunset westernmaryland was
Mount Tabor Church Graveyard, a two minute exposure by PhotosToArtByMike
Sunset Over Dunker Church by trainmann1, door windows red sky sun white building brick green church grass stone clouds md nikon war maryland
Sunset Over Dunker Church by trainmann1
On our way through rural Maryland by jennifer glass, square squareformat iphoneography instagramapp uploaded:by=instagram foursquare:venue=4dcc5243ae60b8
On our way through rural Maryland by jennifer glass
Antietam Sunrise by gkuchera, Sunrise at Antietam National Battlefield (American Civil War) - 9exp HDRsunrise nikon antietam hdr h
Antietam Sunrise by gkuchera
Antietam Sunrise by goldenanchor, Sunrise at Antietam National Battlefield as seen from the Visitors Center. The September 17, 1862 B
Antietam Sunrise by goldenanchor
_RWB5807.jpg by Ron '53, Sunrise over Antietam © 2016 by Ronald Berg <a href="http://rwberg53.wix.com/adventure-images" rel="
_RWB5807.jpg by Ron '53
Dam 5 Sunset and waterfall by lanicoise, Dam 5 on the Potomac River. Photographed for a low light photography class where the assignment was
Dam 5 Sunset and waterfall by lanicoise
Sunset and the Creek by Matthew Singer, Wouldn't you know it, after 2+ feet of snow fell on us, the sun came out and even provided me with a
Sunset and the Creek by Matthew Singer
130724-4620 Antietam by WashuOtaku, Standing along Cornfield Avenue, near the Smoketown Road intersection; the sun setting in the west,
130724-4620 Antietam by WashuOtaku
Civil War Experience by Chef Scott, 161st Anniversary @ Antietam National Battlefield, followed by a visit to Duffields Depot Raid on Ju
Civil War Experience by Chef Scott
_RWB6238.jpg by Ron '53, Sunrise in The Cornfield, September 17, 2012 © 2016 by Ronald Berg <a href="http://rwberg53.wix.com/
_RWB6238.jpg by Ron '53
Campsite at Sunset by asciipip,
Campsite at Sunset by asciipip
National Road, sunset, western edge of Hagerstown, Maryland by Christopher Busta-Peck, old history architecture buildings driving maryland historic roads cumberlandroad nationalroad washi
National Road, sunset, western edge of Hagerstown, Maryland by Christopher Busta-Peck
_RWB6256.jpg by Ron '53, South edge of The Cornfield at sunrise, September 17, 2012 © 2016 by Ronald Berg <a href="http://rwb
_RWB6256.jpg by Ron '53
A Beautiful Place of Death by Get The Flick, The rising sun reveals the beauty of the Antietam National Battlefield near Sharpsburg, Maryland. O
A Beautiful Place of Death by Get The Flick
Antietam National Battlefield in Washington County, Maryland by chesbayprogram, Antietam National Battlefield is seen at sunset in Sharpsburg, Md., on Nov. 5, 2017. The battle of A
Antietam National Battlefield in Washington County, Maryland by chesbayprogram
The Potomac at Sunset by asciipip,
The Potomac at Sunset by asciipip
Sunrise by Kordite, bike geotagged bicycling biking cocanal chesapeakeandohiocanal
Sunrise by Kordite