Timezone:Eastern Standard Time
Current Time:Wednesday, November 11, 2026 9:48 PM
Longitude:-77.884613
Latitude:39.593763
Sunrise Time Today:6:52:27 AM
Sunset Time Today:5:01:23 PM
Daylength Today:10h 8m 55s
Sunrise Time Tomorrow:6:53:37 AM
Sunset Time Tomorrow:5:00:30 PM
Daylength Tomorrow:10h 6m 53s

: Show All Dates

Date Sunrise Time Sunset Time Daylength
Jan 1, 2026 7:33:18 AM 4:58:15 PM 9h 24m 57s
Feb 1, 2026 7:21:29 AM 5:30:57 PM 10h 9m 28s
Mar 1, 2026 6:47:40 AM 6:03:27 PM 11h 15m 47s
Apr 1, 2026 6:58:39 AM 7:35:04 PM 12h 36m 24s
May 1, 2026 6:14:54 AM 8:05:00 PM 13h 50m 6s
Jun 1, 2026 5:47:56 AM 8:33:25 PM 14h 45m 28s
Jul 1, 2026 5:48:22 AM 8:44:18 PM 14h 55m 55s
Aug 1, 2026 6:11:05 AM 8:27:11 PM 14h 16m 6s
Sep 1, 2026 6:40:10 AM 7:46:37 PM 13h 6m 27s
Oct 1, 2026 7:07:47 AM 6:57:46 PM 11h 49m 59s
Nov 1, 2026 7:39:52 AM 6:12:53 PM 10h 33m 0s
Nov 12, 2026 6:52:27 AM 5:01:23 PM 10h 8m 55s
Nov 13, 2026 6:53:37 AM 5:00:30 PM 10h 6m 53s
Dec 1, 2026 7:13:27 AM 4:49:56 PM 9h 36m 29s

Sunrise & Sunset Photos

Electrics at Sunset in Hagerstown by DJ Witty, Two Conrail E44s lead four RF&P GPs on an eastbound freight over the Western Maryland Railway at
Electrics at Sunset in Hagerstown by DJ Witty
Falling by Scott of SWPA, A quick evening, sunset shot over Falling Waters, WV. Thank you for looking and please do NOT use
Falling by Scott of SWPA
Sunset On The Six Eight by T-3 Photography, A view of yesterday's sunset from Maryland 68, near Clear Spring. This HDR image was created from t
Sunset On The Six Eight by T-3 Photography
Hagerstown MD City Park statue at sundown by PhotosToArtByMike, Print size 13x19 inches.sunset fountain statue sundown artmuseum citypark westernmaryland washington
Hagerstown MD City Park statue at sundown by PhotosToArtByMike
BLUE HOUR ABOVE THE POTOMAC by The Wright Photography of Things, Winchester and Western 86 was running late this evening by about an hour. It made for this incredibl
BLUE HOUR ABOVE THE POTOMAC by The Wright Photography of Things
A Farmer's Footprints in Fields of Gold by jeffsmallwood, Drove past this spot in the pre-dawn light and didn't notice it. The sun was up on my way back and I
A Farmer's Footprints in Fields of Gold by jeffsmallwood
Sunrise Over South Mountain by T-3 Photography, A few of the sunrise over South Mountain from behind the Zion United Church of Christ Church in Hage
Sunrise Over South Mountain by T-3 Photography
A Hagerstown Sunrise, MT. Tabor Church and Cemetary by PhotosToArtByMike, Mt. Tabor Church, about 10 miles west of Hagerstown is near the Appalachian Mountains. Print size 1
A Hagerstown Sunrise, MT. Tabor Church and Cemetary by PhotosToArtByMike
Indian Springs Sunset by T-3 Photography, Along Indian Springs Rd near Big Pool, MD.sunset mountains rural canon maryland westernmaryland 5dma
Indian Springs Sunset by T-3 Photography
Hagerstown MD, the City Park at twilight by PhotosToArtByMike, Print size 8x10 inches.sunset landscape twilight sundown scenic artmuseum citypark westernmaryland w
Hagerstown MD, the City Park at twilight by PhotosToArtByMike
Digital colored pencil sketch on course paper surface by PhotosToArtByMike, Cushwa's Coal and Brick warehouse on the C&O Canal Towpath, Williamsport Maryland. Print size 8x
Digital colored pencil sketch on course paper surface by PhotosToArtByMike
The Mount Tabor Church Graveyard at sunset by PhotosToArtByMike, Mt. Tabor Church cemetery, Hagerstown Maryland. Print size 13x19 inches. sunset westernmaryland was
The Mount Tabor Church Graveyard at sunset by PhotosToArtByMike
Clouds over Hagerstown, Maryland by SchuminWeb, Clouds over Hagerstown, Maryland near Valley Mall, at sunset. <i>Ben Schumin is a professional phot
Clouds over Hagerstown, Maryland by SchuminWeb
Double Set by T-3 Photography, Last night's sunset over the Potomac River.
Double Set by T-3 Photography
Mountain View by T-3 Photography, A view west from US-40 just up the hill from Clear Spring, MD.sunset mountains rural canon maryland
Mountain View by T-3 Photography
WW 86 - Falling Waters, WV by T-3 Photography, An evening northbound meanders its way through Falling Waters on it's way to Norfolk Southern's Vard
WW 86 - Falling Waters, WV by T-3 Photography
Morning on the Conococheague Creek in Williamsport MD by PhotosToArtByMike, Print size 13x19 inches. morning sunrise landscape md scenic maryland potomacriver cocanal cushwa ca
Morning on the Conococheague Creek in Williamsport MD by PhotosToArtByMike
Burning Through by trainmann1, For as long as I can remember, my parents have done what's called "Living History Camping"
Burning Through by trainmann1
Williamsport, MD: Waffle House (digital) by smohundro, sunset sky building sign maryland wafflehouse williamsport sunoco kodachrome64preset
Williamsport, MD: Waffle House (digital) by smohundro
A Swan in the the Cushwa Basin, Williamsport MD by PhotosToArtByMike, Print size 8x10 inches. Shot at early morning sunrise.swan md maryland potomacriver cocanal cushwa c
A Swan in the the Cushwa Basin, Williamsport MD by PhotosToArtByMike
CUSHWA BASIN SUNSET by The Wright Photography of Things, CUSHWA BASIN SUNSET The Chesapeake and Ohio Canal, once an important industrial link to the region n
CUSHWA BASIN SUNSET by The Wright Photography of Things
Cushwa's Coal and Brick warehouse, Williamsport MD by PhotosToArtByMike, Got up early for this sunrise. Print size 13x19 inches.sunrise md maryland potomacriver cocanal cus
Cushwa's Coal and Brick warehouse, Williamsport MD by PhotosToArtByMike
Sunset on the Potomac River by JoelDeluxe, trees sunset river dusk wv westvirginia frame potomac joeldeluxe shepherdstown clearwater substrate
Sunset on the Potomac River by JoelDeluxe
Mount Tabor Church, Hagerstown Maryland by PhotosToArtByMike, Mt. Tabor Church, about 10 miles west of Hagerstown is near the Appalachian Mountains. Print size 1
Mount Tabor Church, Hagerstown Maryland by PhotosToArtByMike
Moonrise over Hagerstown Speedway by Glenn Courtney, race md maryland racing dirt opal oval hagerstown sprintcar pennsylvaniasprintcarspeedweek
Moonrise over Hagerstown Speedway by Glenn Courtney
A digital painting of the Cushwa's Coal and Brick warehouse by PhotosToArtByMike, Cushwa's Coal and Brick warehouse, Williamsport Maryland. Print Size 13x19 inches.sunrise md marylan
A digital painting of the Cushwa's Coal and Brick warehouse by PhotosToArtByMike
Hold Tight by jeffsmallwood, This tree really is leaning out over the water, it isn't just the low angle perspective that makes i
Hold Tight by jeffsmallwood
Concocheague Aqueduct Foggy by Runninghounds Photography, Out at 6 am this morning with Adam down by the Potomac River in Williamsport, MD. There was a lazy
Concocheague Aqueduct Foggy by Runninghounds Photography
Sunrise in Martinsburg WV after Jonas Jan. 25, 2016 by mj56p, iPhone photo, manipulated in Waterloque, & adjusted in Aperture
Sunrise in Martinsburg WV after Jonas Jan. 25, 2016 by mj56p
Mount Tabor Church Graveyard, a two minute exposure by PhotosToArtByMike, Mt. Tabor Church cemetery, Hagerstown Maryland. Print size 13x19 inches. sunset westernmaryland was
Mount Tabor Church Graveyard, a two minute exposure by PhotosToArtByMike
On our way through rural Maryland by jennifer glass, square squareformat iphoneography instagramapp uploaded:by=instagram foursquare:venue=4dcc5243ae60b8
On our way through rural Maryland by jennifer glass
Dam 5 Sunset and waterfall by lanicoise, Dam 5 on the Potomac River. Photographed for a low light photography class where the assignment was
Dam 5 Sunset and waterfall by lanicoise
Sunset and the Creek by Matthew Singer, Wouldn't you know it, after 2+ feet of snow fell on us, the sun came out and even provided me with a
Sunset and the Creek by Matthew Singer
Riding Into the Sunset by The Wright Photography of Things,
Riding Into the Sunset by The Wright Photography of Things
Campsite at Sunset by asciipip,
Campsite at Sunset by asciipip
National Road, sunset, western edge of Hagerstown, Maryland by Christopher Busta-Peck, old history architecture buildings driving maryland historic roads cumberlandroad nationalroad washi
National Road, sunset, western edge of Hagerstown, Maryland by Christopher Busta-Peck
The Potomac at Sunset by asciipip,
The Potomac at Sunset by asciipip
Sunrise by Kordite, bike geotagged bicycling biking cocanal chesapeakeandohiocanal
Sunrise by Kordite
Sunset at NCTC by JoelDeluxe, sunset cloud clouds cloudy hotair balloon wv stopsign westvirginia potomac hotairballoon daycare joe
Sunset at NCTC by JoelDeluxe
Victorian farmhouse at sunrise, Conococheague, Maryland by Christopher Busta-Peck, old morning house history sunshine rural buildings dawn driving farm victorian maryland historic roa
Victorian farmhouse at sunrise, Conococheague, Maryland by Christopher Busta-Peck
Sunset by Runninghounds Photography, The sun came out from behind the clouds this evening and I managed to get this shot before it vanish
Sunset by Runninghounds Photography
Whittington Construction Group (301) 573-2832 by Whittington Construction Group, Leading construction company that specializes in all types of home remodeling, building and renovati
Whittington Construction Group (301) 573-2832 by Whittington Construction Group
Lonely Rails In The Sunset by The Wright Photography of Things,
Lonely Rails In The Sunset by The Wright Photography of Things
Rufus Wilson Complex at sunrise, Conococheague, Maryland by Christopher Busta-Peck, This group of buildings, on the historic National Road, is on the <a href="http://www.marylandhistor
Rufus Wilson Complex at sunrise, Conococheague, Maryland by Christopher Busta-Peck
eagle nest tree sunset by weedmandan, At the National Conservation Training Center Shepherdstown, West Virginia
eagle nest tree sunset by weedmandan
Saving the best for last... by Matthew Singer, I posted what I thought was my best shot first. So I saved my second best shot for last. This was ac
Saving the best for last... by Matthew Singer
Church, Conococheague, Maryland, at sunrise by Christopher Busta-Peck, This view shows a tiny portion of the old National Road (between the church and the barn). old histo
Church, Conococheague, Maryland, at sunrise by Christopher Busta-Peck
Ft. Frederick; Big Pool, MD by kev_moore, uploaded:by=flickrmobile flickriosapp:filter=nofilter
Ft. Frederick; Big Pool, MD by kev_moore
Clear Spring, MD by lsheirer, sunset sky clouds canon
Clear Spring, MD by lsheirer
On the Turning Away by scott_prestridge, <i>The more one does and sees and feels, the more one is able to do, and the more genuine may be one
On the Turning Away by scott_prestridge
canal moody 4 by hicsuget, Same scene, different night (note the absence of snow on the bank), different mood. No fewer than 5
canal moody 4 by hicsuget
Upstream on the Potomac by JoelDeluxe, trees sunset river panoramic wv westvirginia potomac joeldeluxe shepherdstown nctc nationalconservat
Upstream on the Potomac by JoelDeluxe
Sunday Dawn by RobertCMurray, Was trying to get the lady and her kid in the stroller, ended up making a neat sunrise photo. tree s
Sunday Dawn by RobertCMurray
Winter Sunrise by fab_lac, Martinsburg, WV
Winter Sunrise by fab_lac
Winter Sunrise by fab_lac, Martinsburg, WV
Winter Sunrise by fab_lac
Remnants of Green Days by Matthew Singer, Vines and other weeds are the only plants, other than trees and shrubs, to stick out through the sno
Remnants of Green Days by Matthew Singer
Reflecting the Past by scott_prestridge, sunset sky cloud reflection nature water river canal md nps bank towpath choh iphoneography iphone4s
Reflecting the Past by scott_prestridge
McCoys Ferry by JJWard Design, An active area during the Civil War. For more information see: <a href="http://www.canaltrust.org/d
McCoys Ferry by JJWard Design
Mallard hen by hicsuget, Mallard hen at sunsetbirds animals geese pond wildlife ducks waterfowl
Mallard hen by hicsuget
Wilson School, Conococheague, Maryland by Christopher Busta-Peck, This school, built 1859-1860, is on the <a href="http://www.marylandhistoricaltrust.net/nr/NRDetail.
Wilson School, Conococheague, Maryland by Christopher Busta-Peck