Zona horaria:hora estándar oriental
Hora local:lunes, 9 de noviembre de 2026 9:09
Longitud:-77.7108686
Latitud:39.5837385
Amanecer hoy:6:49:26
Atardecer hoy:17:02:34
Horas de luz hoy:10h 13m 7s
Amanecer mañana:6:50:35
Atardecer mañana:17:01:38
Horas de luz mañana:10h 11m 2s

: Mostrar todas las fechas

Fecha Salida de sol Puesta de sol Duración del día
1 de ene. de 2026 7:32:34 16:57:35 9h 25m 0s
1 de feb. de 2026 7:20:46 17:30:16 10h 9m 30s
1 de mar. de 2026 6:46:58 18:02:46 11h 15m 48s
1 de abr. de 2026 6:57:58 19:34:22 12h 36m 23s
1 de may. de 2026 6:14:13 20:04:17 13h 50m 4s
1 de jun. de 2026 5:47:17 20:32:42 14h 45m 25s
1 de jul. de 2026 5:47:43 20:43:35 14h 55m 52s
1 de ago. de 2026 6:10:24 20:26:28 14h 16m 4s
1 de sep. de 2026 6:39:29 19:45:55 13h 6m 26s
1 de oct. de 2026 7:07:05 18:57:05 11h 49m 59s
1 de nov. de 2026 7:39:10 18:12:12 10h 33m 2s
9 de nov. de 2026 6:48:17 17:03:32 10h 15m 14s
10 de nov. de 2026 6:49:26 17:02:34 10h 13m 7s
1 de dic. de 2026 7:12:43 16:49:16 9h 36m 32s

Fotos de amanecer y atardecer

Sunset, lake and hills !! by dpbirds, Lovely sunset at Greenbrier State Park in Maryland. Photo by: Darshan Vaishnav <a href="http://www
Sunset, lake and hills !! by dpbirds
Sundown over Greenbrier Lake at Greenbrier State Park, Maryland by PhotosToArtByMike, Greenbrier Lake is beautifully set with an Appalachian Mountain back drop. The lake is surrounded b
Sundown over Greenbrier Lake at Greenbrier State Park, Maryland by PhotosToArtByMike
Hagerstown, Maryland, USA by takasphoto.com, Living in California for a while, we sometimes miss the east coast - from these impressive clouds, g
Hagerstown, Maryland, USA by takasphoto.com
Electrics at Sunset in Hagerstown by DJ Witty, Two Conrail E44s lead four RF&P GPs on an eastbound freight over the Western Maryland Railway at
Electrics at Sunset in Hagerstown by DJ Witty
130724-4644 Antietam by WashuOtaku, Monument to the 132nd Pennsylvania Volunteer Infantry Regiment; located within Sunken Road (Bloody L
130724-4644 Antietam by WashuOtaku
Falling by Scott of SWPA, A quick evening, sunset shot over Falling Waters, WV. Thank you for looking and please do NOT use
Falling by Scott of SWPA
Good Morning Tree by jeffsmallwood, While I was at Antietam Battlefield for sunrise the sky was changing dramatically from minute to min
Good Morning Tree by jeffsmallwood
Hagerstown MD City Park statue at sundown by PhotosToArtByMike, Print size 13x19 inches.sunset fountain statue sundown artmuseum citypark westernmaryland washington
Hagerstown MD City Park statue at sundown by PhotosToArtByMike
BLUE HOUR ABOVE THE POTOMAC by The Wright Photography of Things, Winchester and Western 86 was running late this evening by about an hour. It made for this incredibl
BLUE HOUR ABOVE THE POTOMAC by The Wright Photography of Things
Hagerstown MD City Park Art Museum at sundown by PhotosToArtByMike, Caught a nice sunset at the park. The lights in the museum lit up as I snapped the photo. Print siz
Hagerstown MD City Park Art Museum at sundown by PhotosToArtByMike
Sunrise Over South Mountain by T-3 Photography, A few of the sunrise over South Mountain from behind the Zion United Church of Christ Church in Hage
Sunrise Over South Mountain by T-3 Photography
Hagerstown MD, the City Park at twilight by PhotosToArtByMike, Print size 8x10 inches.sunset landscape twilight sundown scenic artmuseum citypark westernmaryland w
Hagerstown MD, the City Park at twilight by PhotosToArtByMike
Digital colored pencil sketch on course paper surface by PhotosToArtByMike, Cushwa's Coal and Brick warehouse on the C&O Canal Towpath, Williamsport Maryland. Print size 8x
Digital colored pencil sketch on course paper surface by PhotosToArtByMike
Sunset at Washington Monument by DJ Witty, Kodak Ektar 100 Nikon FM2Nphotography kodakektar100 washingtonmonument nikonfm2 fm2n nikon sunset ko
Sunset at Washington Monument by DJ Witty
Double Set by T-3 Photography, Last night's sunset over the Potomac River.
Double Set by T-3 Photography
Clouds over Hagerstown, Maryland by SchuminWeb, Clouds over Hagerstown, Maryland near Valley Mall, at sunset. <i>Ben Schumin is a professional phot
Clouds over Hagerstown, Maryland by SchuminWeb
Bridge Over Antietam Creek by jeffsmallwood, This spot is several miles from <a href="http://www.nps.gov/ANTI/" target="blank" rel="nofollow">Ant
Bridge Over Antietam Creek by jeffsmallwood
Antietam's Bloody Lane by TheGreenHeron, Snake rail fence along Bloody Lane, Antietam National Battlefield, Sharpsburg Maryland. I liked the
Antietam's Bloody Lane by TheGreenHeron
On The Opposite Side by jeffsmallwood, This <a href="http://www.flickr.com/photos/jeffsmallwood/5673169265/in/photostream" target="blank">f
On The Opposite Side by jeffsmallwood
Something New by jeffsmallwood, I've been playing with some different post-processing techniques, trying some combinations of things
Something New by jeffsmallwood
Sunrise at Antietam Battlefield by jeffsmallwood, Here's another shot from sunrise at Antietam Battlefield. It's quite a feeling to sit in battlefield
Sunrise at Antietam Battlefield by jeffsmallwood
Antietam Valley Sunset by Msanders55, Along Branch Avenue on the southern end of the Antietam battlefield.autumn sunset landscape fallcolo
Antietam Valley Sunset by Msanders55
Antietam Battlefield circa 2011 by jeffsmallwood, The <a href="http://en.wikipedia.org/wiki/Battle_of_Antietam" target="blank" rel="nofollow">Battle o
Antietam Battlefield circa 2011 by jeffsmallwood
Antietam Battlefield, the Maryland Monument at sundown by PhotosToArtByMike, Print size 8x10 inches.sunset landscape md sundown scenic maryland antietambattlefield sharpsburgmd
Antietam Battlefield, the Maryland Monument at sundown by PhotosToArtByMike
The Cornfield by stackingpixels, Antietam at 150fog sunrise day thecornfield uploaded:by=flickrmobile flickriosapp:filter=nofilter
The Cornfield by stackingpixels
Morning on the Conococheague Creek in Williamsport MD by PhotosToArtByMike, Print size 13x19 inches. morning sunrise landscape md scenic maryland potomacriver cocanal cushwa ca
Morning on the Conococheague Creek in Williamsport MD by PhotosToArtByMike
Williamsport, MD: Waffle House (digital) by smohundro, sunset sky building sign maryland wafflehouse williamsport sunoco kodachrome64preset
Williamsport, MD: Waffle House (digital) by smohundro
Hagerstown, Maryland, USA by takasphoto.com, Living in California for a while, we sometimes miss the east coast - from these impressive clouds, g
Hagerstown, Maryland, USA by takasphoto.com
A Swan in the the Cushwa Basin, Williamsport MD by PhotosToArtByMike, Print size 8x10 inches. Shot at early morning sunrise.swan md maryland potomacriver cocanal cushwa c
A Swan in the the Cushwa Basin, Williamsport MD by PhotosToArtByMike
Antietam - The Maryland Monument at sundown by PhotosToArtByMike, Print size 8x10 inches.sunset landscape md sundown scenic maryland antietambattlefield sharpsburgmd
Antietam - The Maryland Monument at sundown by PhotosToArtByMike
CUSHWA BASIN SUNSET by The Wright Photography of Things, CUSHWA BASIN SUNSET The Chesapeake and Ohio Canal, once an important industrial link to the region n
CUSHWA BASIN SUNSET by The Wright Photography of Things
Cushwa's Coal and Brick warehouse, Williamsport MD by PhotosToArtByMike, Got up early for this sunrise. Print size 13x19 inches.sunrise md maryland potomacriver cocanal cus
Cushwa's Coal and Brick warehouse, Williamsport MD by PhotosToArtByMike
Sunset on the Potomac River by JoelDeluxe, trees sunset river dusk wv westvirginia frame potomac joeldeluxe shepherdstown clearwater substrate
Sunset on the Potomac River by JoelDeluxe
Sundog above the 130th PA Infantry - Antietam by ronzzo1, cwt13bf nikond80nationalparkbattlefieldantietamsharpsburgmarylandcivilwarmonumentrainbow130thpainfan
Sundog above the 130th PA Infantry - Antietam by ronzzo1
Moonrise over Hagerstown Speedway by Glenn Courtney, race md maryland racing dirt opal oval hagerstown sprintcar pennsylvaniasprintcarspeedweek
Moonrise over Hagerstown Speedway by Glenn Courtney
Annapolis Rock at Sunrise by Caleb McCary, red fall foliage colors panorama iphone iphone8plus sunrise maryland annapolisrock
Annapolis Rock at Sunrise by Caleb McCary
Antietam, sunset in the North Woods by Msanders55, Monument for the 36th Pennsylvania Infantry, near the Poffenberger Farm and the North Woods. This wa
Antietam, sunset in the North Woods by Msanders55
137th PA Infantry at Sunrise - Antietam by ronzzo1, cwt13bf nikondslrd80civilwarbattlefieldmarylandantietamsharpsburgnationalparkmonument
137th PA Infantry at Sunrise - Antietam by ronzzo1
Antietam Battlefield by Victor Dvorak, Site of the bloodiest one-day battle of the Civil War with approximately 23,000 casualties (killed,
Antietam Battlefield by Victor Dvorak
Hold Tight by jeffsmallwood, This tree really is leaning out over the water, it isn't just the low angle perspective that makes i
Hold Tight by jeffsmallwood
Concocheague Aqueduct Foggy by Runninghounds Photography, Out at 6 am this morning with Adam down by the Potomac River in Williamsport, MD. There was a lazy
Concocheague Aqueduct Foggy by Runninghounds Photography
Week 46 - Landscape Foreground by Caleb McCary, Sunrise at Annapolis Rock.fallcolors autumn foliage iphone8plus annapolisrock maryland sunrise lands
Week 46 - Landscape Foreground by Caleb McCary
Sunset Over Dunker Church by trainmann1, door windows red sky sun white building brick green church grass stone clouds md nikon war maryland
Sunset Over Dunker Church by trainmann1
130724-4619 Antietam by WashuOtaku, <b>The East Woods <i>"The shells crashing through the trees and fluttering overhead as well as
130724-4619 Antietam by WashuOtaku
Canada Hill Sundown by Msanders55, Up on Canada Hill, looking southeast down the Middletown valley, Maryland. The town of Myersville is
Canada Hill Sundown by Msanders55
Antietam Sunset 1 by Vicki's Pics, Taken in the parking lot by Burnside Bridge.sunset antietamnationalbattlefield
Antietam Sunset 1 by Vicki's Pics
Autumn afternoon view from tower on South Mountain: Washington Monument State Park, Maryland by Msanders55, statepark autumn sunset mountain tower fallcolor maryland vista southmountain
Autumn afternoon view from tower on South Mountain: Washington Monument State Park, Maryland by Msanders55
On our way through rural Maryland by jennifer glass, square squareformat iphoneography instagramapp uploaded:by=instagram foursquare:venue=4dcc5243ae60b8
On our way through rural Maryland by jennifer glass
Sunset, St. Paul's Lutheran Church Cemetery, Myersville, Maryland, September 2021 by lisby1,
Sunset, St. Paul's Lutheran Church Cemetery, Myersville, Maryland, September 2021 by lisby1
Washington Monument, Boonsboro sundown 1 by Msanders55, Shot from the top of the Washington Monument tower, South Mountain, Maryland.statepark autumn sunset
Washington Monument, Boonsboro sundown 1 by Msanders55
Afternoon view from the Washington Monument on South Mountain, Maryland by Msanders55, Looking northwesterly across the Maryland portion of the Cumberland Valley.statepark fallcolor maryl
Afternoon view from the Washington Monument on South Mountain, Maryland by Msanders55
Burnsides Bridge, Antietam National Battlefield, Sharpsburg, Maryland by Runninghounds Photography, Went out early this morning to shoot some at Antietam. The sunrise was non-discript and rather disap
Burnsides Bridge, Antietam National Battlefield, Sharpsburg, Maryland by Runninghounds Photography
Ice Reflections by pinnacle_ls, Sometimes the iPhone can surprise me. Took this a few days after an ice storm up on South Mountain
Ice Reflections by pinnacle_ls
Antietam Sunrise by gkuchera, Sunrise at Antietam National Battlefield (American Civil War) - 9exp HDRsunrise nikon antietam hdr h
Antietam Sunrise by gkuchera
Sundown Barn, South Mountain by Msanders55, sunset barn maryland southmountain middletownvalleymaryland
Sundown Barn, South Mountain by Msanders55
Irish Brigade Memorial, Antietam Battlefield by Naturalist & Photographer Steve DaCosta, Sunset at Antietam National Battlefield hits the face of the Irish Brigade Monument, which was made
Irish Brigade Memorial, Antietam Battlefield by Naturalist & Photographer Steve DaCosta
Willow Watching the Dawn by Room With A View, Photo by my daughter, Tam. Her dog, Willow watching the sunrise behind the Catoctin Mountains.willow
Willow Watching the Dawn by Room With A View
_RWB5807.jpg by Ron '53, Sunrise over Antietam © 2016 by Ronald Berg <a href="http://rwberg53.wix.com/adventure-images" rel="
_RWB5807.jpg by Ron '53
Greenbrier Lake by HubbleColor {Zolt}, autumn trees mist lake fall forest sunrise maryland greenbrierstatepark 1210216518
Greenbrier Lake by HubbleColor {Zolt}
Boonsboro Wedding, Maryland, USA by takasphoto.com, <b> TAKASPHOTO.COM || <a href="https://www.flickr.com/photos/takataira/">Flickr</a> || <a href="htt
Boonsboro Wedding, Maryland, USA by takasphoto.com