Zona horaria:hora de verano oriental
Hora local:miércoles, 16 de septiembre de 2026 4:16
Longitud:-77.8081363
Latitud:39.5991924
Amanecer hoy:6:54:30
Atardecer hoy:19:20:32
Horas de luz hoy:12h 26m 1s
Amanecer mañana:6:55:25
Atardecer mañana:19:18:53
Horas de luz mañana:12h 23m 27s

: Mostrar todas las fechas

Fecha Salida de sol Puesta de sol Duración del día
1 de ene. de 2026 7:33:00 16:57:56 9h 24m 55s
1 de feb. de 2026 7:21:11 17:30:38 10h 9m 26s
1 de mar. de 2026 6:47:22 18:03:09 11h 15m 46s
1 de abr. de 2026 6:58:21 19:34:46 12h 36m 25s
1 de may. de 2026 6:14:35 20:04:42 13h 50m 7s
1 de jun. de 2026 5:47:37 20:33:08 14h 45m 30s
1 de jul. de 2026 5:48:03 20:44:01 14h 55m 57s
1 de ago. de 2026 6:10:45 20:26:54 14h 16m 8s
1 de sep. de 2026 6:39:52 19:46:20 13h 6m 28s
16 de sep. de 2026 6:53:36 19:22:11 12h 28m 35s
17 de sep. de 2026 6:54:30 19:20:32 12h 26m 1s
1 de oct. de 2026 7:07:28 18:57:28 11h 49m 59s
1 de nov. de 2026 7:39:34 18:12:34 10h 32m 59s
1 de dic. de 2026 7:13:09 16:49:37 9h 36m 27s

Fotos de amanecer y atardecer

Home to the Shadows by jeffsmallwood, I'd planned to get up early and go shooting, but I couldn't sleep which made it much easier to get m
Home to the Shadows by jeffsmallwood
Hagerstown, Maryland, USA by takasphoto.com, Living in California for a while, we sometimes miss the east coast - from these impressive clouds, g
Hagerstown, Maryland, USA by takasphoto.com
Hagerstown, Maryland, USA by takasphoto.com, Living in California for a while, we sometimes miss the east coast - from these impressive clouds, g
Hagerstown, Maryland, USA by takasphoto.com
Electrics at Sunset in Hagerstown by DJ Witty, Two Conrail E44s lead four RF&P GPs on an eastbound freight over the Western Maryland Railway at
Electrics at Sunset in Hagerstown by DJ Witty
130724-4644 Antietam by WashuOtaku, Monument to the 132nd Pennsylvania Volunteer Infantry Regiment; located within Sunken Road (Bloody L
130724-4644 Antietam by WashuOtaku
Falling by Scott of SWPA, A quick evening, sunset shot over Falling Waters, WV. Thank you for looking and please do NOT use
Falling by Scott of SWPA
The Sunken Road, Antietam National Battlefield - Sharpsburg Maryland by JM & K2-YSNP, Photo by Jonmikelbattlefield civilwar maryland
The Sunken Road, Antietam National Battlefield - Sharpsburg Maryland by JM & K2-YSNP
The Sky of Hagerstown in Dusk, Maryland, USA by takasphoto.com, Living in California for a while, we sometimes miss the east coast - from these impressive clouds, g
The Sky of Hagerstown in Dusk, Maryland, USA by takasphoto.com
Sunset On The Six Eight by T-3 Photography, A view of yesterday's sunset from Maryland 68, near Clear Spring. This HDR image was created from t
Sunset On The Six Eight by T-3 Photography
Good Morning Tree by jeffsmallwood, While I was at Antietam Battlefield for sunrise the sky was changing dramatically from minute to min
Good Morning Tree by jeffsmallwood
Hagerstown MD City Park statue at sundown by PhotosToArtByMike, Print size 13x19 inches.sunset fountain statue sundown artmuseum citypark westernmaryland washington
Hagerstown MD City Park statue at sundown by PhotosToArtByMike
BLUE HOUR ABOVE THE POTOMAC by The Wright Photography of Things, Winchester and Western 86 was running late this evening by about an hour. It made for this incredibl
BLUE HOUR ABOVE THE POTOMAC by The Wright Photography of Things
A Farmer's Footprints in Fields of Gold by jeffsmallwood, Drove past this spot in the pre-dawn light and didn't notice it. The sun was up on my way back and I
A Farmer's Footprints in Fields of Gold by jeffsmallwood
Sunrise Over South Mountain by T-3 Photography, A few of the sunrise over South Mountain from behind the Zion United Church of Christ Church in Hage
Sunrise Over South Mountain by T-3 Photography
A Hagerstown Sunrise, MT. Tabor Church and Cemetary by PhotosToArtByMike, Mt. Tabor Church, about 10 miles west of Hagerstown is near the Appalachian Mountains. Print size 1
A Hagerstown Sunrise, MT. Tabor Church and Cemetary by PhotosToArtByMike
Hagerstown MD, the City Park at twilight by PhotosToArtByMike, Print size 8x10 inches.sunset landscape twilight sundown scenic artmuseum citypark westernmaryland w
Hagerstown MD, the City Park at twilight by PhotosToArtByMike
Digital colored pencil sketch on course paper surface by PhotosToArtByMike, Cushwa's Coal and Brick warehouse on the C&O Canal Towpath, Williamsport Maryland. Print size 8x
Digital colored pencil sketch on course paper surface by PhotosToArtByMike
The Mount Tabor Church Graveyard at sunset by PhotosToArtByMike, Mt. Tabor Church cemetery, Hagerstown Maryland. Print size 13x19 inches. sunset westernmaryland was
The Mount Tabor Church Graveyard at sunset by PhotosToArtByMike
Double Set by T-3 Photography, Last night's sunset over the Potomac River.
Double Set by T-3 Photography
Mountain View by T-3 Photography, A view west from US-40 just up the hill from Clear Spring, MD.sunset mountains rural canon maryland
Mountain View by T-3 Photography
Bridge Over Antietam Creek by jeffsmallwood, This spot is several miles from <a href="http://www.nps.gov/ANTI/" target="blank" rel="nofollow">Ant
Bridge Over Antietam Creek by jeffsmallwood
WW 86 - Falling Waters, WV by T-3 Photography, An evening northbound meanders its way through Falling Waters on it's way to Norfolk Southern's Vard
WW 86 - Falling Waters, WV by T-3 Photography
Antietam's Bloody Lane by TheGreenHeron, Snake rail fence along Bloody Lane, Antietam National Battlefield, Sharpsburg Maryland. I liked the
Antietam's Bloody Lane by TheGreenHeron
On The Opposite Side by jeffsmallwood, This <a href="http://www.flickr.com/photos/jeffsmallwood/5673169265/in/photostream" target="blank">f
On The Opposite Side by jeffsmallwood
Something New by jeffsmallwood, I've been playing with some different post-processing techniques, trying some combinations of things
Something New by jeffsmallwood
Sunrise at Antietam Battlefield by jeffsmallwood, Here's another shot from sunrise at Antietam Battlefield. It's quite a feeling to sit in battlefield
Sunrise at Antietam Battlefield by jeffsmallwood
Antietam Battlefield circa 2011 by jeffsmallwood, The <a href="http://en.wikipedia.org/wiki/Battle_of_Antietam" target="blank" rel="nofollow">Battle o
Antietam Battlefield circa 2011 by jeffsmallwood
Antietam Battlefield, the Maryland Monument at sundown by PhotosToArtByMike, Print size 8x10 inches.sunset landscape md sundown scenic maryland antietambattlefield sharpsburgmd
Antietam Battlefield, the Maryland Monument at sundown by PhotosToArtByMike
The Cornfield by stackingpixels, Antietam at 150fog sunrise day thecornfield uploaded:by=flickrmobile flickriosapp:filter=nofilter
The Cornfield by stackingpixels
Morning on the Conococheague Creek in Williamsport MD by PhotosToArtByMike, Print size 13x19 inches. morning sunrise landscape md scenic maryland potomacriver cocanal cushwa ca
Morning on the Conococheague Creek in Williamsport MD by PhotosToArtByMike
Hagerstown, Maryland, USA by takasphoto.com, Living in California for a while, we sometimes miss the east coast - from these impressive clouds, g
Hagerstown, Maryland, USA by takasphoto.com
Williamsport, MD: Waffle House (digital) by smohundro, sunset sky building sign maryland wafflehouse williamsport sunoco kodachrome64preset
Williamsport, MD: Waffle House (digital) by smohundro
Antietam - The Maryland Monument at sundown by PhotosToArtByMike, Print size 8x10 inches.sunset landscape md sundown scenic maryland antietambattlefield sharpsburgmd
Antietam - The Maryland Monument at sundown by PhotosToArtByMike
CUSHWA BASIN SUNSET by The Wright Photography of Things, CUSHWA BASIN SUNSET The Chesapeake and Ohio Canal, once an important industrial link to the region n
CUSHWA BASIN SUNSET by The Wright Photography of Things
Cushwa's Coal and Brick warehouse, Williamsport MD by PhotosToArtByMike, Got up early for this sunrise. Print size 13x19 inches.sunrise md maryland potomacriver cocanal cus
Cushwa's Coal and Brick warehouse, Williamsport MD by PhotosToArtByMike
gnarled by Eric Sturdivant, longexposure sky usa tree clouds us md unitedstates unitedstatesofamerica maryland places antietam l
gnarled by Eric Sturdivant
The Cornfield by stackingpixels, Antietam at 150sunrise day clear thecornfield uploaded:by=flickrmobile flickriosapp:filter=nofilter
The Cornfield by stackingpixels
Sunset on the Potomac River by JoelDeluxe, trees sunset river dusk wv westvirginia frame potomac joeldeluxe shepherdstown clearwater substrate
Sunset on the Potomac River by JoelDeluxe
Sundog above the 130th PA Infantry - Antietam by ronzzo1, cwt13bf nikond80nationalparkbattlefieldantietamsharpsburgmarylandcivilwarmonumentrainbow130thpainfan
Sundog above the 130th PA Infantry - Antietam by ronzzo1
Mount Tabor Church, Hagerstown Maryland by PhotosToArtByMike, Mt. Tabor Church, about 10 miles west of Hagerstown is near the Appalachian Mountains. Print size 1
Mount Tabor Church, Hagerstown Maryland by PhotosToArtByMike
Moonrise over Hagerstown Speedway by Glenn Courtney, race md maryland racing dirt opal oval hagerstown sprintcar pennsylvaniasprintcarspeedweek
Moonrise over Hagerstown Speedway by Glenn Courtney
Antietam, sunset in the North Woods by Msanders55, Monument for the 36th Pennsylvania Infantry, near the Poffenberger Farm and the North Woods. This wa
Antietam, sunset in the North Woods by Msanders55
A digital painting of the Cushwa's Coal and Brick warehouse by PhotosToArtByMike, Cushwa's Coal and Brick warehouse, Williamsport Maryland. Print Size 13x19 inches.sunrise md marylan
A digital painting of the Cushwa's Coal and Brick warehouse by PhotosToArtByMike
Antietam Battlefield by Victor Dvorak, Site of the bloodiest one-day battle of the Civil War with approximately 23,000 casualties (killed,
Antietam Battlefield by Victor Dvorak
Hold Tight by jeffsmallwood, This tree really is leaning out over the water, it isn't just the low angle perspective that makes i
Hold Tight by jeffsmallwood
Concocheague Aqueduct Foggy by Runninghounds Photography, Out at 6 am this morning with Adam down by the Potomac River in Williamsport, MD. There was a lazy
Concocheague Aqueduct Foggy by Runninghounds Photography
130724-4619 Antietam by WashuOtaku, <b>The East Woods <i>"The shells crashing through the trees and fluttering overhead as well as
130724-4619 Antietam by WashuOtaku
Mount Tabor Church Graveyard, a two minute exposure by PhotosToArtByMike, Mt. Tabor Church cemetery, Hagerstown Maryland. Print size 13x19 inches. sunset westernmaryland was
Mount Tabor Church Graveyard, a two minute exposure by PhotosToArtByMike
Sunset Over Dunker Church by trainmann1, door windows red sky sun white building brick green church grass stone clouds md nikon war maryland
Sunset Over Dunker Church by trainmann1
On our way through rural Maryland by jennifer glass, square squareformat iphoneography instagramapp uploaded:by=instagram foursquare:venue=4dcc5243ae60b8
On our way through rural Maryland by jennifer glass
Antietam Sunrise by gkuchera, Sunrise at Antietam National Battlefield (American Civil War) - 9exp HDRsunrise nikon antietam hdr h
Antietam Sunrise by gkuchera
Antietam Sunrise by goldenanchor, Sunrise at Antietam National Battlefield as seen from the Visitors Center. The September 17, 1862 B
Antietam Sunrise by goldenanchor
Irish Brigade Memorial, Antietam Battlefield by Naturalist & Photographer Steve DaCosta, Sunset at Antietam National Battlefield hits the face of the Irish Brigade Monument, which was made
Irish Brigade Memorial, Antietam Battlefield by Naturalist & Photographer Steve DaCosta
_RWB5807.jpg by Ron '53, Sunrise over Antietam © 2016 by Ronald Berg <a href="http://rwberg53.wix.com/adventure-images" rel="
_RWB5807.jpg by Ron '53
Dam 5 Sunset and waterfall by lanicoise, Dam 5 on the Potomac River. Photographed for a low light photography class where the assignment was
Dam 5 Sunset and waterfall by lanicoise
Antietam Sunset by Runninghounds Photography, The New York State monument is silhouetted by the sunset. With the threat of stroms in the afternoon
Antietam Sunset by Runninghounds Photography
Sunset and the Creek by Matthew Singer, Wouldn't you know it, after 2+ feet of snow fell on us, the sun came out and even provided me with a
Sunset and the Creek by Matthew Singer
130724-4620 Antietam by WashuOtaku, Standing along Cornfield Avenue, near the Smoketown Road intersection; the sun setting in the west,
130724-4620 Antietam by WashuOtaku
Civil War Experience by Chef Scott, 161st Anniversary @ Antietam National Battlefield, followed by a visit to Duffields Depot Raid on Ju
Civil War Experience by Chef Scott
_RWB6238.jpg by Ron '53, Sunrise in The Cornfield, September 17, 2012 © 2016 by Ronald Berg <a href="http://rwberg53.wix.com/
_RWB6238.jpg by Ron '53