Zeitzone:Nordamerikanische Ostküsten-Normalzeit
Ortszeit:Montag, 9. November 2026 07:23
Länge:-77.76536830294339
Breite:39.618040449999995
Sonnenaufgang Heute:06:49:43
Sonnenuntergang Heute:17:02:43
Tageslänge heute:10h 12m 59s
Sonnenaufgang morgen:06:50:53
Sonnenuntergang Morgen:17:01:46
Tageslänge von morgen:10h 10m 53s

: Alle Termine anzeigen

Datum Sonnenaufgang Sonnenuntergang Tageslänge
1. Jan. 2026 07:32:53 16:57:42 9h 24m 48s
1. Feb. 2026 07:21:03 17:30:25 10h 9m 21s
1. März 2026 06:47:13 18:02:57 11h 15m 44s
1. Apr. 2026 06:58:10 19:34:36 12h 36m 26s
1. Mai 2026 06:14:22 20:04:34 13h 50m 11s
1. Juni 2026 05:47:24 20:33:01 14h 45m 37s
1. Juli 2026 05:47:49 20:43:54 14h 56m 5s
1. Aug. 2026 06:10:32 20:26:46 14h 16m 13s
1. Sep. 2026 06:39:40 19:46:11 13h 6m 30s
1. Okt. 2026 07:07:19 18:57:17 11h 49m 58s
1. Nov. 2026 07:39:26 18:12:22 10h 32m 55s
9. Nov. 2026 06:48:34 17:03:41 10h 15m 6s
10. Nov. 2026 06:49:43 17:02:43 10h 12m 59s
1. Dez. 2026 07:13:02 16:49:23 9h 36m 21s

Fotos von Sonnenaufgang und Sonnenuntergang

Home to the Shadows by jeffsmallwood, I'd planned to get up early and go shooting, but I couldn't sleep which made it much easier to get m
Home to the Shadows by jeffsmallwood
Sunset, lake and hills !! by dpbirds, Lovely sunset at Greenbrier State Park in Maryland. Photo by: Darshan Vaishnav <a href="http://www
Sunset, lake and hills !! by dpbirds
Hagerstown, Maryland, USA by takasphoto.com, Living in California for a while, we sometimes miss the east coast - from these impressive clouds, g
Hagerstown, Maryland, USA by takasphoto.com
Sundown over Greenbrier Lake at Greenbrier State Park, Maryland by PhotosToArtByMike, Greenbrier Lake is beautifully set with an Appalachian Mountain back drop. The lake is surrounded b
Sundown over Greenbrier Lake at Greenbrier State Park, Maryland by PhotosToArtByMike
Electrics at Sunset in Hagerstown by DJ Witty, Two Conrail E44s lead four RF&P GPs on an eastbound freight over the Western Maryland Railway at
Electrics at Sunset in Hagerstown by DJ Witty
Falling by Scott of SWPA, A quick evening, sunset shot over Falling Waters, WV. Thank you for looking and please do NOT use
Falling by Scott of SWPA
The Sky of Hagerstown in Dusk, Maryland, USA by takasphoto.com, Living in California for a while, we sometimes miss the east coast - from these impressive clouds, g
The Sky of Hagerstown in Dusk, Maryland, USA by takasphoto.com
Sunset On The Six Eight by T-3 Photography, A view of yesterday's sunset from Maryland 68, near Clear Spring. This HDR image was created from t
Sunset On The Six Eight by T-3 Photography
Hagerstown MD City Park statue at sundown by PhotosToArtByMike, Print size 13x19 inches.sunset fountain statue sundown artmuseum citypark westernmaryland washington
Hagerstown MD City Park statue at sundown by PhotosToArtByMike
BLUE HOUR ABOVE THE POTOMAC by The Wright Photography of Things, Winchester and Western 86 was running late this evening by about an hour. It made for this incredibl
BLUE HOUR ABOVE THE POTOMAC by The Wright Photography of Things
A Farmer's Footprints in Fields of Gold by jeffsmallwood, Drove past this spot in the pre-dawn light and didn't notice it. The sun was up on my way back and I
A Farmer's Footprints in Fields of Gold by jeffsmallwood
Hagerstown MD City Park Art Museum at sundown by PhotosToArtByMike, Caught a nice sunset at the park. The lights in the museum lit up as I snapped the photo. Print siz
Hagerstown MD City Park Art Museum at sundown by PhotosToArtByMike
Sunrise Over South Mountain by T-3 Photography, A few of the sunrise over South Mountain from behind the Zion United Church of Christ Church in Hage
Sunrise Over South Mountain by T-3 Photography
A Hagerstown Sunrise, MT. Tabor Church and Cemetary by PhotosToArtByMike, Mt. Tabor Church, about 10 miles west of Hagerstown is near the Appalachian Mountains. Print size 1
A Hagerstown Sunrise, MT. Tabor Church and Cemetary by PhotosToArtByMike
Hagerstown MD, the City Park at twilight by PhotosToArtByMike, Print size 8x10 inches.sunset landscape twilight sundown scenic artmuseum citypark westernmaryland w
Hagerstown MD, the City Park at twilight by PhotosToArtByMike
Digital colored pencil sketch on course paper surface by PhotosToArtByMike, Cushwa's Coal and Brick warehouse on the C&O Canal Towpath, Williamsport Maryland. Print size 8x
Digital colored pencil sketch on course paper surface by PhotosToArtByMike
The Mount Tabor Church Graveyard at sunset by PhotosToArtByMike, Mt. Tabor Church cemetery, Hagerstown Maryland. Print size 13x19 inches. sunset westernmaryland was
The Mount Tabor Church Graveyard at sunset by PhotosToArtByMike
Double Set by T-3 Photography, Last night's sunset over the Potomac River.
Double Set by T-3 Photography
Bridge Over Antietam Creek by jeffsmallwood, This spot is several miles from <a href="http://www.nps.gov/ANTI/" target="blank" rel="nofollow">Ant
Bridge Over Antietam Creek by jeffsmallwood
WW 86 - Falling Waters, WV by T-3 Photography, An evening northbound meanders its way through Falling Waters on it's way to Norfolk Southern's Vard
WW 86 - Falling Waters, WV by T-3 Photography
The Cornfield by stackingpixels, Antietam at 150fog sunrise day thecornfield uploaded:by=flickrmobile flickriosapp:filter=nofilter
The Cornfield by stackingpixels
Morning on the Conococheague Creek in Williamsport MD by PhotosToArtByMike, Print size 13x19 inches. morning sunrise landscape md scenic maryland potomacriver cocanal cushwa ca
Morning on the Conococheague Creek in Williamsport MD by PhotosToArtByMike
Hagerstown, Maryland, USA by takasphoto.com, Living in California for a while, we sometimes miss the east coast - from these impressive clouds, g
Hagerstown, Maryland, USA by takasphoto.com
Williamsport, MD: Waffle House (digital) by smohundro, sunset sky building sign maryland wafflehouse williamsport sunoco kodachrome64preset
Williamsport, MD: Waffle House (digital) by smohundro
A Swan in the the Cushwa Basin, Williamsport MD by PhotosToArtByMike, Print size 8x10 inches. Shot at early morning sunrise.swan md maryland potomacriver cocanal cushwa c
A Swan in the the Cushwa Basin, Williamsport MD by PhotosToArtByMike
Cushwa's Coal and Brick warehouse, Williamsport MD by PhotosToArtByMike, Got up early for this sunrise. Print size 13x19 inches.sunrise md maryland potomacriver cocanal cus
Cushwa's Coal and Brick warehouse, Williamsport MD by PhotosToArtByMike
gnarled by Eric Sturdivant, longexposure sky usa tree clouds us md unitedstates unitedstatesofamerica maryland places antietam l
gnarled by Eric Sturdivant
The Cornfield by stackingpixels, Antietam at 150sunrise day clear thecornfield uploaded:by=flickrmobile flickriosapp:filter=nofilter
The Cornfield by stackingpixels
Sunset on the Potomac River by JoelDeluxe, trees sunset river dusk wv westvirginia frame potomac joeldeluxe shepherdstown clearwater substrate
Sunset on the Potomac River by JoelDeluxe
Mount Tabor Church, Hagerstown Maryland by PhotosToArtByMike, Mt. Tabor Church, about 10 miles west of Hagerstown is near the Appalachian Mountains. Print size 1
Mount Tabor Church, Hagerstown Maryland by PhotosToArtByMike
Moonrise over Hagerstown Speedway by Glenn Courtney, race md maryland racing dirt opal oval hagerstown sprintcar pennsylvaniasprintcarspeedweek
Moonrise over Hagerstown Speedway by Glenn Courtney
Annapolis Rock at Sunrise by Caleb McCary, red fall foliage colors panorama iphone iphone8plus sunrise maryland annapolisrock
Annapolis Rock at Sunrise by Caleb McCary
Antietam, sunset in the North Woods by Msanders55, Monument for the 36th Pennsylvania Infantry, near the Poffenberger Farm and the North Woods. This wa
Antietam, sunset in the North Woods by Msanders55
A digital painting of the Cushwa's Coal and Brick warehouse by PhotosToArtByMike, Cushwa's Coal and Brick warehouse, Williamsport Maryland. Print Size 13x19 inches.sunrise md marylan
A digital painting of the Cushwa's Coal and Brick warehouse by PhotosToArtByMike
Hold Tight by jeffsmallwood, This tree really is leaning out over the water, it isn't just the low angle perspective that makes i
Hold Tight by jeffsmallwood
Week 46 - Landscape Foreground by Caleb McCary, Sunrise at Annapolis Rock.fallcolors autumn foliage iphone8plus annapolisrock maryland sunrise lands
Week 46 - Landscape Foreground by Caleb McCary
130724-4619 Antietam by WashuOtaku, <b>The East Woods <i>"The shells crashing through the trees and fluttering overhead as well as
130724-4619 Antietam by WashuOtaku
On our way through rural Maryland by jennifer glass, square squareformat iphoneography instagramapp uploaded:by=instagram foursquare:venue=4dcc5243ae60b8
On our way through rural Maryland by jennifer glass
Mount Tabor Church Graveyard, a two minute exposure by PhotosToArtByMike, Mt. Tabor Church cemetery, Hagerstown Maryland. Print size 13x19 inches. sunset westernmaryland was
Mount Tabor Church Graveyard, a two minute exposure by PhotosToArtByMike
Antietam Sunrise by gkuchera, Sunrise at Antietam National Battlefield (American Civil War) - 9exp HDRsunrise nikon antietam hdr h
Antietam Sunrise by gkuchera
Willow Watching the Dawn by Room With A View, Photo by my daughter, Tam. Her dog, Willow watching the sunrise behind the Catoctin Mountains.willow
Willow Watching the Dawn by Room With A View
Dam 5 Sunset and waterfall by lanicoise, Dam 5 on the Potomac River. Photographed for a low light photography class where the assignment was
Dam 5 Sunset and waterfall by lanicoise
Greenbrier Lake by HubbleColor {Zolt}, autumn trees mist lake fall forest sunrise maryland greenbrierstatepark 1210216518
Greenbrier Lake by HubbleColor {Zolt}
130724-4620 Antietam by WashuOtaku, Standing along Cornfield Avenue, near the Smoketown Road intersection; the sun setting in the west,
130724-4620 Antietam by WashuOtaku
Civil War Experience by Chef Scott, 161st Anniversary @ Antietam National Battlefield, followed by a visit to Duffields Depot Raid on Ju
Civil War Experience by Chef Scott
_RWB6238.jpg by Ron '53, Sunrise in The Cornfield, September 17, 2012 © 2016 by Ronald Berg <a href="http://rwberg53.wix.com/
_RWB6238.jpg by Ron '53
National Road, sunset, western edge of Hagerstown, Maryland by Christopher Busta-Peck, old history architecture buildings driving maryland historic roads cumberlandroad nationalroad washi
National Road, sunset, western edge of Hagerstown, Maryland by Christopher Busta-Peck
Antietam National Battlefield in Washington County, Maryland by chesbayprogram, Antietam National Battlefield is seen at sunset in Sharpsburg, Md., on Nov. 5, 2017. The battle of A
Antietam National Battlefield in Washington County, Maryland by chesbayprogram
Sunrise by Kordite, bike geotagged bicycling biking cocanal chesapeakeandohiocanal
Sunrise by Kordite
Sunset at NCTC by JoelDeluxe, sunset cloud clouds cloudy hotair balloon wv stopsign westvirginia potomac hotairballoon daycare joe
Sunset at NCTC by JoelDeluxe
Painted Across the Sky by veritas123, The clouds were great. light sunset sun home colors clouds backyard nikond3100
Painted Across the Sky by veritas123
Civil War Experience by Chef Scott, 161st Anniversary @ Antietam National Battlefield, followed by a visit to Duffields Depot Raid on Ju
Civil War Experience by Chef Scott
Civil War Experience by Chef Scott, 161st Anniversary @ Antietam National Battlefield, followed by a visit to Duffields Depot Raid on Ju
Civil War Experience by Chef Scott
Sunset by Runninghounds Photography, The sun came out from behind the clouds this evening and I managed to get this shot before it vanish
Sunset by Runninghounds Photography
Civil War Experience by Chef Scott, 161st Anniversary @ Antietam National Battlefield, followed by a visit to Duffields Depot Raid on Ju
Civil War Experience by Chef Scott
Whittington Construction Group (301) 573-2832 by Whittington Construction Group, Leading construction company that specializes in all types of home remodeling, building and renovati
Whittington Construction Group (301) 573-2832 by Whittington Construction Group
Sunset Silos by ctdevaughn, sunset farm maryland silos hagerstown maugansville uploaded:by=flickrmobile flickriosapp:filter=nofi
Sunset Silos by ctdevaughn
Sunset by Runninghounds Photography, Ran out of work because I knew it was going to be another good sunset on Wednesday. This one is nea
Sunset by Runninghounds Photography
_RWB6215-Edit-Edit-2-Edit-Edit.jpg by Ron '53, The Cornfield view toward East Woods (*appeared in Hallowed Ground Fall 2015 p47) © 2016 by Ronald B
_RWB6215-Edit-Edit-2-Edit-Edit.jpg by Ron '53
I Will Write My Love Above A Mountain by veritas123, It wasn't as cold tonight, so I sat on my back deck and watched the sun set as my mom made steaks.
I Will Write My Love Above A Mountain by veritas123